Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SPAG16 protein

This Human SPAG16 protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pf20 protein homolog

UniProt

Q8N0X2

Expression Region

1-183aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-198AA: 1-183AAFull Length : Full Length of Isoform 4

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptgdr sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3929704 1.0 µg DNA

Ptgdr sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ZNF419 sgRNA CRISPR Lentivector (Human) (Target 3)
K2705004 1.0 µg DNA

ZNF419 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Goat Angiopoietin 2 ELISA Kit
MBS030146 Inquire

Goat Angiopoietin 2 ELISA Kit

Sign In for Pricing
View Details
PPFIBP1 antibody
70R-1229 100 ug

PPFIBP1 antibody

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae CGSHiGG_01960 Protein (aa 1-119)
VAng-Lsx03153-500gEcoli 500 µg (E. coli)

Recombinant Haemophilus Influenzae CGSHiGG_01960 Protein (aa 1-119)

Sign In for Pricing
View Details
Rabbit Anti-BUB1B Recombinant Antibody (clone 7H4)
ZG-0575J Each

Rabbit Anti-BUB1B Recombinant Antibody (clone 7H4)

Sign In for Pricing
View Details