Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human POLR1D protein

This Human POLR1D protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AC19 DNA-directed RNA polymerase I subunit D RNA polymerase I 16KDA subunit

UniProt

P0DPB6

Expression Region

1-133aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-252AA: 1-133AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LRCH2 Protein (C-His)
BP2841-50ug 50 µg

Recombinant Human LRCH2 Protein (C-His)

Sign In for Pricing
View Details
CCT8 Antibody, HRP conjugated
MBS7047842-01 0.05 mg

CCT8 Antibody, HRP conjugated

Sign In for Pricing
View Details
CCT8 Antibody, HRP conjugated
MBS7047842-02 0.1 mg

CCT8 Antibody, HRP conjugated

Sign In for Pricing
View Details
CCT8 Antibody, HRP conjugated
MBS7047842-03 5x 0.1 mg

CCT8 Antibody, HRP conjugated

Sign In for Pricing
View Details
CLDN2 Human Recombinant Protein, Synthetic Nanodisc
TP721449M 100 µg

CLDN2 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
Rabbit Polyclonal PUM2 Antibody [Biotin]
NBP2-98727B 0.1 mL

Rabbit Polyclonal PUM2 Antibody [Biotin]

Sign In for Pricing
View Details