Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LAMTOR3 protein

This Human LAMTOR3 protein spans the amino acid sequence from region 1-124aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3

UniProt

Q9UHA4

Expression Region

1-124aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-182AA: 1-124AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cga shRNA (UAS) - Lentiviral mouse Cga shRNA (UAS, iRFP) plasmid
GTR15245032 1 Vial

Lentiviral mouse Cga shRNA (UAS) - Lentiviral mouse Cga shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
ELISA Kit for Lysyl Oxidase Like Protein 2 (LOXL2)
TRV-0048192-01 24 Tests

ELISA Kit for Lysyl Oxidase Like Protein 2 (LOXL2)

Sign In for Pricing
View Details
ELISA Kit for Lysyl Oxidase Like Protein 2 (LOXL2)
TRV-0048192-02 48 Tests

ELISA Kit for Lysyl Oxidase Like Protein 2 (LOXL2)

Sign In for Pricing
View Details
ELISA Kit for Lysyl Oxidase Like Protein 2 (LOXL2)
TRV-0048192-03 96 Tests

ELISA Kit for Lysyl Oxidase Like Protein 2 (LOXL2)

Sign In for Pricing
View Details
ELISA Kit for Lysyl Oxidase Like Protein 2 (LOXL2)
TRV-0048192-04 5x 96 Tests

ELISA Kit for Lysyl Oxidase Like Protein 2 (LOXL2)

Sign In for Pricing
View Details
ELISA Kit for Lysyl Oxidase Like Protein 2 (LOXL2)
TRV-0048192-05 10x 96 Tests

ELISA Kit for Lysyl Oxidase Like Protein 2 (LOXL2)

Sign In for Pricing
View Details