Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LAMTOR3 protein

This Human LAMTOR3 protein spans the amino acid sequence from region 1-124aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3

UniProt

Q9UHA4

Expression Region

1-124aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-182AA: 1-124AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kcng3 shRNA (UAS) - Lentiviral mouse Kcng3 shRNA (UAS) (25)
GTR15277085 1 Vial

Lentiviral mouse Kcng3 shRNA (UAS) - Lentiviral mouse Kcng3 shRNA (UAS) (25)

Sign In for Pricing
View Details
DDX1 Recombinant Protein (Mouse)
RP128333 100 µg

DDX1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
GLRX3 Antibody
orb1254885 100 µL

GLRX3 Antibody

Sign In for Pricing
View Details
Rno-miR-421-3p mimic
HY-R04460-01 5 nmol

Rno-miR-421-3p mimic

Sign In for Pricing
View Details
Rno-miR-421-3p mimic
HY-R04460-02 20 nmol

Rno-miR-421-3p mimic

Sign In for Pricing
View Details
GRK1 Rabbit Polyclonal Antibody (BF680)
orb2549512 100 µL

GRK1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details