Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GSTA2 protein

This Human GSTA2 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2

UniProt

P09210

Expression Region

1-222aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-184AA: 1-222AAFull Length : Full Length of BC002895

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lacrein CRISPR Activation Plasmid (m)
sc-436596-ACT 20 µg

Lacrein CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
D6Wsu116e Protein Vector (Mouse) (pPB-N-His)
PV170255 500 ng

D6Wsu116e Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
PTAR1, ID (Protein Prenyltransferase alpha Subunit Repeat-containing Protein 1) (Azide free) (HRP) discontinued
P5664-70-HRP 200 µL

PTAR1, ID (Protein Prenyltransferase alpha Subunit Repeat-containing Protein 1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
SCARB1/Scavenger Receptor BI Rabbit Polyclonal Antibody
orb526559-01 50 μL

SCARB1/Scavenger Receptor BI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCARB1/Scavenger Receptor BI Rabbit Polyclonal Antibody
orb526559-02 100 µL

SCARB1/Scavenger Receptor BI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCARB1/Scavenger Receptor BI Rabbit Polyclonal Antibody
orb526559-03 200 µL

SCARB1/Scavenger Receptor BI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details