What is the catalog number for Human GSTA2 protein?

The catalog number for Human GSTA2 protein is orb54297.

What sizes are available for Human GSTA2 protein?

Human GSTA2 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human GSTA2 protein come in?

Human GSTA2 protein is available in 3 different pack sizes.

Is Human GSTA2 protein in stock?

Human GSTA2 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human GSTA2 protein

This Human GSTA2 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2

UniProt

P09210

Expression Region

1-222aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-184AA: 1-222AAFull Length : Full Length of BC002895

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF