Human GLO1 protein
This Human GLO1 protein spans the amino acid sequence from region 1-184aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Aldoketomutase Glyoxalase I
UniProt
Q04760
Expression Region
1-184aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
47.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-117AA: 1-184AAFull Length of BC025791 : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2884687-01 48 Well
Human Interleukin-6 receptor subunit alpha ELISA Kit
Sign In for Pricing
View Details MBS2884687-02 96 Well
Human Interleukin-6 receptor subunit alpha ELISA Kit
Sign In for Pricing
View Details MBS2884687-03 5x 96 Well
Human Interleukin-6 receptor subunit alpha ELISA Kit
Sign In for Pricing
View Details MBS2884687-04 10x 96 Well
Human Interleukin-6 receptor subunit alpha ELISA Kit
Sign In for Pricing
View Details 
MBS554327-01 1 mg
Sheep Platelet Derived Growth Factor-BB Recombinant
Sign In for Pricing
View Details MBS554327-02 5 mg
Sheep Platelet Derived Growth Factor-BB Recombinant
Sign In for Pricing
View Details