Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GHRL protein

This Human GHRL protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth hormone secretagogue Growth hormone-releasing peptide Motilin-related peptide Protein M46

UniProt

Q9UBU3

Expression Region

1-117aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-162AA: 1-117AAFull Length of Isoform 2 : Full Length of BC025791

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab17 (NM_008998) Mouse Untagged Clone
MC204653 10 µg

Rab17 (NM_008998) Mouse Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Nlrp4f shRNA (UAS) - Lentiviral mouse Nlrp4f shRNA (UAS, RFP) plasmid
GTR15133021 1 Vial

Lentiviral mouse Nlrp4f shRNA (UAS) - Lentiviral mouse Nlrp4f shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit A Disintegrin And Metalloprotease 1 (ADAMTS1) ELISA Kit
YP-W72165-01 48 Tests

Rabbit A Disintegrin And Metalloprotease 1 (ADAMTS1) ELISA Kit

Sign In for Pricing
View Details
Rabbit A Disintegrin And Metalloprotease 1 (ADAMTS1) ELISA Kit
YP-W72165-02 96 Tests

Rabbit A Disintegrin And Metalloprotease 1 (ADAMTS1) ELISA Kit

Sign In for Pricing
View Details
FN3KRP (Fructosamine-3-kinase-related Protein, FN3KL) (APC)
MBS6417488-01 0.1 mL

FN3KRP (Fructosamine-3-kinase-related Protein, FN3KL) (APC)

Sign In for Pricing
View Details
FN3KRP (Fructosamine-3-kinase-related Protein, FN3KL) (APC)
MBS6417488-02 5x 0.1 mL

FN3KRP (Fructosamine-3-kinase-related Protein, FN3KL) (APC)

Sign In for Pricing
View Details