Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DIRAS3 protein

This Human DIRAS3 protein spans the amino acid sequence from region 1-229aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Distinct subgroup of the Ras family member 3 Rho-related GTP-binding protein RhoI

UniProt

O95661

Expression Region

1-229aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-337AA: 1-229AAFull Length of BC028723 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-FUT10 antibody
SL16197R-01 50 µL

Rabbit Anti-FUT10 antibody

Sign In for Pricing
View Details
Rabbit Anti-FUT10 antibody
SL16197R-02 100 µL

Rabbit Anti-FUT10 antibody

Sign In for Pricing
View Details
Anti-PDK1 Monoclonal Antibody
MBS1752079-01 0.03 mL

Anti-PDK1 Monoclonal Antibody

Sign In for Pricing
View Details
Anti-PDK1 Monoclonal Antibody
MBS1752079-02 0.1 mL

Anti-PDK1 Monoclonal Antibody

Sign In for Pricing
View Details
Anti-PDK1 Monoclonal Antibody
MBS1752079-03 5x 0.1 mL

Anti-PDK1 Monoclonal Antibody

Sign In for Pricing
View Details
TSPAN15 Antibody
CSB-PA025152LA01HU-01 50 µg

TSPAN15 Antibody

Sign In for Pricing
View Details