Human ASCC3 protein
This Human ASCC3 protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ASC-1 complex subunit p200
UniProt
Q8N3C0
Expression Region
1-111aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
40 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-223AA: 1-111AAFull Length : Full Length of Isoform 2
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7259559-01 48 Well
Goat Olfactory Receptor 7C1 (OR7C1) ELISA Kit
Sign In for Pricing
View Details MBS7259559-02 96 Well
Goat Olfactory Receptor 7C1 (OR7C1) ELISA Kit
Sign In for Pricing
View Details MBS7259559-03 5x 96 Well
Goat Olfactory Receptor 7C1 (OR7C1) ELISA Kit
Sign In for Pricing
View Details MBS7259559-04 10x 96 Well
Goat Olfactory Receptor 7C1 (OR7C1) ELISA Kit
Sign In for Pricing
View Details 