Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FABP5 protein

Recombinant human FABP5 protein

Product Specifications

Product Name Alternative

Epidermal-type fatty acid-binding protein1 Publication E-FABP1 Publication Fatty acid-binding protein, epidermal Psoriasis-associated fatty acid-binding protein homolog

UniProt

Q01469

Expression Region

1-135aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-376AA: 1-135AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boric Acid, 500g
PR0607-500g 500 g

Boric Acid, 500g

Sign In for Pricing
View Details
Monkey Vacuolar-Sorting Protein SNF8 (SNF8) ELISA Kit
MBS9943412-01 48 Well

Monkey Vacuolar-Sorting Protein SNF8 (SNF8) ELISA Kit

Sign In for Pricing
View Details
Monkey Vacuolar-Sorting Protein SNF8 (SNF8) ELISA Kit
MBS9943412-02 96 Well

Monkey Vacuolar-Sorting Protein SNF8 (SNF8) ELISA Kit

Sign In for Pricing
View Details
Monkey Vacuolar-Sorting Protein SNF8 (SNF8) ELISA Kit
MBS9943412-03 5x 96 Well

Monkey Vacuolar-Sorting Protein SNF8 (SNF8) ELISA Kit

Sign In for Pricing
View Details
Monkey Vacuolar-Sorting Protein SNF8 (SNF8) ELISA Kit
MBS9943412-04 10x 96 Well

Monkey Vacuolar-Sorting Protein SNF8 (SNF8) ELISA Kit

Sign In for Pricing
View Details
Toll Like Receptor 4 (TLR4) Antibody (Biotin)
abx446358 100 µg

Toll Like Receptor 4 (TLR4) Antibody (Biotin)

Sign In for Pricing
View Details