Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FABP5 protein

Recombinant human FABP5 protein

Product Specifications

Product Name Alternative

Epidermal-type fatty acid-binding protein1 Publication E-FABP1 Publication Fatty acid-binding protein, epidermal Psoriasis-associated fatty acid-binding protein homolog

UniProt

Q01469

Expression Region

1-135aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-376AA: 1-135AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclooxygenase-2, CT (PTGS2, Prostaglandin G/H Synthase 2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, COX2, Prostaglandin-endoperoxide Synthase 2) discontinued
C7904-83P 250 µL

Cyclooxygenase-2, CT (PTGS2, Prostaglandin G/H Synthase 2, COX-2, PHS II, Prostaglandin H2 Synthase 2, PGH Synthase 2, PGHS-2, COX2, Prostaglandin-endoperoxide Synthase 2) discontinued

Sign In for Pricing
View Details
VpreB (H-11) PE
sc-514957 PE 200 µg/mL

VpreB (H-11) PE

Sign In for Pricing
View Details
Human PPP4R1 Protein Lysate 20ug
IHUPPP4R1PLLY20UG 20 µg

Human PPP4R1 Protein Lysate 20ug

Sign In for Pricing
View Details
CLEC6A Conjugated Antibody
C37525 100 µL

CLEC6A Conjugated Antibody

Sign In for Pricing
View Details
OTX1 + OTX2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-11958R-BF488-TR 20 µL

OTX1 + OTX2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
8-Fluoroisatoic anhydride
277968-01 250 mg

8-Fluoroisatoic anhydride

Sign In for Pricing
View Details