Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A12 protein

This Human S100A12 protein spans the amino acid sequence from region 2-92aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CGRP Calcium-binding protein in amniotic fluid 1

UniProt

P80511

Expression Region

2-92aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-166AA: 1-92AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACC2 Mouse Monoclonal Antibody [Clone ID: LBI8A5]
AMM16465V 100 µL

TACC2 Mouse Monoclonal Antibody [Clone ID: LBI8A5]

Sign In for Pricing
View Details
Recombinant Brain Derived Neurotrophic Factor (BDNF)
SIPA007Hu01-01 10 µg

Recombinant Brain Derived Neurotrophic Factor (BDNF)

Sign In for Pricing
View Details
Recombinant Brain Derived Neurotrophic Factor (BDNF)
SIPA007Hu01-02 50 µg

Recombinant Brain Derived Neurotrophic Factor (BDNF)

Sign In for Pricing
View Details
Recombinant Brain Derived Neurotrophic Factor (BDNF)
SIPA007Hu01-03 200 µg

Recombinant Brain Derived Neurotrophic Factor (BDNF)

Sign In for Pricing
View Details
Recombinant Brain Derived Neurotrophic Factor (BDNF)
SIPA007Hu01-04 1 mg

Recombinant Brain Derived Neurotrophic Factor (BDNF)

Sign In for Pricing
View Details
Recombinant Brain Derived Neurotrophic Factor (BDNF)
SIPA007Hu01-05 5 mg

Recombinant Brain Derived Neurotrophic Factor (BDNF)

Sign In for Pricing
View Details