Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A12 protein

This Human S100A12 protein spans the amino acid sequence from region 2-92aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CGRP Calcium-binding protein in amniotic fluid 1

UniProt

P80511

Expression Region

2-92aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-166AA: 1-92AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gremlin-1 Biosimilar (UCB patent GREM1 / Gremlin Reference Antibody)
orb2703738-01 1 mg

Gremlin-1 Biosimilar (UCB patent GREM1 / Gremlin Reference Antibody)

Sign In for Pricing
View Details
Gremlin-1 Biosimilar (UCB patent GREM1 / Gremlin Reference Antibody)
orb2703738-02 5 mg

Gremlin-1 Biosimilar (UCB patent GREM1 / Gremlin Reference Antibody)

Sign In for Pricing
View Details
Gremlin-1 Biosimilar (UCB patent GREM1 / Gremlin Reference Antibody)
orb2703738-03 100 mg

Gremlin-1 Biosimilar (UCB patent GREM1 / Gremlin Reference Antibody)

Sign In for Pricing
View Details
C2orf27 (C2orf27B) (NM_214461) Human Recombinant Protein
TP308144L 1 mg

C2orf27 (C2orf27B) (NM_214461) Human Recombinant Protein

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), Biotin conjugate, 0.1mg/mL
BNCB2602-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rock-2 Polyclonal Conjugated Antibody
C41415 100 µL

Rock-2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details