Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PHYH protein

This Human PHYH protein spans the amino acid sequence from region 1-338aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phytanic acid oxidase Phytanoyl-CoA alpha-hydroxylase

UniProt

O14832

Expression Region

1-338aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-329AA: 1-338AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Superoxide Dismutase 3/SOD3 Rabbit Polyclonal Antibody (HRP)
orb2576443 100 µg

Superoxide Dismutase 3/SOD3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
OCIAD1 (NM_017830) Human Tagged ORF Clone
RC201506 10 µg

OCIAD1 (NM_017830) Human Tagged ORF Clone

Sign In for Pricing
View Details
HIV1 Nef Rabbit Polyclonal Antibody (Biotin)
orb450834 100 µL

HIV1 Nef Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Pan-HLA Antibody / HLA-DP/DQ/DR
V5135-100UG 100 µg

Pan-HLA Antibody / HLA-DP/DQ/DR

Sign In for Pricing
View Details
Bcl11b 3'UTR Lenti-reporter-Luc Vector
13224084 1.0 µg

Bcl11b 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
HCT-8 Luciferase Reporter Cell Line
ABC-RC086H 1 Vial

HCT-8 Luciferase Reporter Cell Line

Sign In for Pricing
View Details