Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PHYH protein

This Human PHYH protein spans the amino acid sequence from region 1-338aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phytanic acid oxidase Phytanoyl-CoA alpha-hydroxylase

UniProt

O14832

Expression Region

1-338aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-329AA: 1-338AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP2, CT (Parp2, Adprt2, Adprtl2, Aspartl2, Poly [ADP-ribose] polymerase 2, ADP-ribosyltransferase diphtheria toxin-like 2, NAD(+) ADP-ribosyltransferase 2, Poly[ADP-ribose] synthase 2) (AP)
MBS6330978-01 0.2 mL

PARP2, CT (Parp2, Adprt2, Adprtl2, Aspartl2, Poly [ADP-ribose] polymerase 2, ADP-ribosyltransferase diphtheria toxin-like 2, NAD(+) ADP-ribosyltransferase 2, Poly[ADP-ribose] synthase 2) (AP)

Sign In for Pricing
View Details
PARP2, CT (Parp2, Adprt2, Adprtl2, Aspartl2, Poly [ADP-ribose] polymerase 2, ADP-ribosyltransferase diphtheria toxin-like 2, NAD(+) ADP-ribosyltransferase 2, Poly[ADP-ribose] synthase 2) (AP)
MBS6330978-02 5x 0.2 mL

PARP2, CT (Parp2, Adprt2, Adprtl2, Aspartl2, Poly [ADP-ribose] polymerase 2, ADP-ribosyltransferase diphtheria toxin-like 2, NAD(+) ADP-ribosyltransferase 2, Poly[ADP-ribose] synthase 2) (AP)

Sign In for Pricing
View Details
Polyclonal C9orf38 Antibody - N-terminal region
APR01702G 0.05mg

Polyclonal C9orf38 Antibody - N-terminal region

Sign In for Pricing
View Details
GOLPH3L Knockout A549 Polyclonal Cells
ARG33577 1 Million

GOLPH3L Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Upstream Binding Protein 1 (UBP1) (NM_014517) Human Over-expression Lysate
LS007342-100ug 100 µg

Upstream Binding Protein 1 (UBP1) (NM_014517) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal ERR beta/NR3B2 Antibody [DyLight 650]
NBP2-99541C 0.1 mL

Rabbit Polyclonal ERR beta/NR3B2 Antibody [DyLight 650]

Sign In for Pricing
View Details