Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NAA50 protein

This Human NAA50 protein spans the amino acid sequence from region 1-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-acetyltransferase 13 N-acetyltransferase 5

UniProt

Q9GZZ1

Expression Region

1-169aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-186AA: 1-169AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament, Light Polypeptide (NEFL) Antibody (FITC)
abx312952-01 20 µg

Neurofilament, Light Polypeptide (NEFL) Antibody (FITC)

Sign In for Pricing
View Details
Neurofilament, Light Polypeptide (NEFL) Antibody (FITC)
abx312952-02 50 µg

Neurofilament, Light Polypeptide (NEFL) Antibody (FITC)

Sign In for Pricing
View Details
Neurofilament, Light Polypeptide (NEFL) Antibody (FITC)
abx312952-03 100 µg

Neurofilament, Light Polypeptide (NEFL) Antibody (FITC)

Sign In for Pricing
View Details
Neurofilament, Light Polypeptide (NEFL) Antibody (FITC)
abx312952-04 200 µg

Neurofilament, Light Polypeptide (NEFL) Antibody (FITC)

Sign In for Pricing
View Details
Neurofilament, Light Polypeptide (NEFL) Antibody (FITC)
abx312952-05 1 mg

Neurofilament, Light Polypeptide (NEFL) Antibody (FITC)

Sign In for Pricing
View Details
EIF3S6IP shRNA (m) Lentiviral Particles
sc-144617-V 200 µL

EIF3S6IP shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details