Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NAA50 protein

This Human NAA50 protein spans the amino acid sequence from region 1-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-acetyltransferase 13 N-acetyltransferase 5

UniProt

Q9GZZ1

Expression Region

1-169aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-186AA: 1-169AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4930521A18Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)
10654124 3x 1.0µg DNA

4930521A18Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
F(ab')2 Goat anti-Human IgG-F(ab')2 Fragment Cross-Adsorbed Antibody DyLight 488 Conjugated
MBS3907001-01 0.5 mg

F(ab')2 Goat anti-Human IgG-F(ab')2 Fragment Cross-Adsorbed Antibody DyLight 488 Conjugated

Sign In for Pricing
View Details
F(ab')2 Goat anti-Human IgG-F(ab')2 Fragment Cross-Adsorbed Antibody DyLight 488 Conjugated
MBS3907001-02 5x 0.5 mg

F(ab')2 Goat anti-Human IgG-F(ab')2 Fragment Cross-Adsorbed Antibody DyLight 488 Conjugated

Sign In for Pricing
View Details
VincuLin (VCL) (NM_003373) Human Recombinant Protein
TP720619M 50 µg

VincuLin (VCL) (NM_003373) Human Recombinant Protein

Sign In for Pricing
View Details
pOTB7-BIN1 Plasmid
PVT26140 2 µg

pOTB7-BIN1 Plasmid

Sign In for Pricing
View Details
RNF10 Recombinant Protein Antigen
NBP2-38672PEP 0.1 mL

RNF10 Recombinant Protein Antigen

Sign In for Pricing
View Details