Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human N6AMT1 protein

This Human N6AMT1 protein spans the amino acid sequence from region 1-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M.HsaHemK2P N (6) -adenine-specific DNA methyltransferase 1

UniProt

Q9Y5N5

Expression Region

1-186aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-256AA: 1-186AAFull Length of BC000990 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Ethyl Norlysergic Acid N,N-Diethylamide
TRC-E925270-5MG 5 mg

N-Ethyl Norlysergic Acid N,N-Diethylamide

Sign In for Pricing
View Details
Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), CF488A conjugate, 0.1mg/mL
BNC882183-500 1x 500 µL

Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DHRS7 Polyclonal Antibody
E-AB-52605-01 20 µL

DHRS7 Polyclonal Antibody

Sign In for Pricing
View Details
DHRS7 Polyclonal Antibody
E-AB-52605-02 60 µL

DHRS7 Polyclonal Antibody

Sign In for Pricing
View Details
DHRS7 Polyclonal Antibody
E-AB-52605-03 120 µL

DHRS7 Polyclonal Antibody

Sign In for Pricing
View Details
DHRS7 Polyclonal Antibody
E-AB-52605-04 200 µL

DHRS7 Polyclonal Antibody

Sign In for Pricing
View Details