Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human N6AMT1 protein

This Human N6AMT1 protein spans the amino acid sequence from region 1-186aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M.HsaHemK2P N (6) -adenine-specific DNA methyltransferase 1

UniProt

Q9Y5N5

Expression Region

1-186aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-256AA: 1-186AAFull Length of BC000990 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCID
SIH-340-50MG 50 mg

TCID

Sign In for Pricing
View Details
COLQ (NM_005677) Human Over-expression Lysate
LC401731 20 µg

COLQ (NM_005677) Human Over-expression Lysate

Sign In for Pricing
View Details
Histidine decarboxylase (HDC) (NM_002112) Human Over-expression Lysate
LY419530 100 µg

Histidine decarboxylase (HDC) (NM_002112) Human Over-expression Lysate

Sign In for Pricing
View Details
CD6 (3F7B5), 0.2mg/mL
BNUB0428-100 1x 100 µL

CD6 (3F7B5), 0.2mg/mL

Sign In for Pricing
View Details
KChIP2 (KCNIP2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI14A7]
TA807451AM 100 µL

KChIP2 (KCNIP2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI14A7]

Sign In for Pricing
View Details
Fluorescent Brightener 28 (Technical Grade)
TRC-F599740-1G 1 g

Fluorescent Brightener 28 (Technical Grade)

Sign In for Pricing
View Details