Human N6AMT1 protein
This Human N6AMT1 protein spans the amino acid sequence from region 1-186aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
M.HsaHemK2P N (6) -adenine-specific DNA methyltransferase 1
UniProt
Q9Y5N5
Expression Region
1-186aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
46.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-256AA: 1-186AAFull Length of BC000990 : Full Length of Isoform 2
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-B285105-1G 1 g
(R)-1-Benzyl-pyrrolidine-2-carboxylic Acid (May Contain up to 15% inorganics)
Sign In for Pricing
View Details 
LC402325 20 µg
Siglec 7 (SIGLEC7) (NM_014385) Human Over-expression Lysate
Sign In for Pricing
View Details ![Glucocorticoid Receptor (NR3C1) Mouse Monoclonal Antibody [Clone ID: OTI7A11]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907e82/imageurl/cf806207.webp)
CF806207 100 µg
Glucocorticoid Receptor (NR3C1) Mouse Monoclonal Antibody [Clone ID: OTI7A11]
Sign In for Pricing
View Details 
BNCB0097-100 1x 100 µL
Nuclear Membrane (NM97), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 