Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HMGN4 protein

This Human HMGN4 protein spans the amino acid sequence from region 1-90aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HMGN4, HMG17L3, NHC, High mobility group nucleosome-binding domain-containing protein 4, Non-histone chromosomal protein HMG-17-like 3, Non-histone chromosomal protein

UniProt

O00479

Expression Region

1-90aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-90AA: 1-90AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-19a-5p miRNA Agomir
CMN0439-01 5 nmol

Mmu-miR-19a-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-19a-5p miRNA Agomir
CMN0439-02 10 nmol

Mmu-miR-19a-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-19a-5p miRNA Agomir
CMN0439-03 20 nmol

Mmu-miR-19a-5p miRNA Agomir

Sign In for Pricing
View Details
TRIM33 Antibody (C-term) Blocking peptide
MBS9220071-01 0.5 mg

TRIM33 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
TRIM33 Antibody (C-term) Blocking peptide
MBS9220071-02 5x 0.5 mg

TRIM33 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
NCDM-32B
orb1699863-01 25 mg

NCDM-32B

Sign In for Pricing
View Details