Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human H2AFZ protein

This Human H2AFZ protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H2A histone family member Z, H2A.z, H2A/z, H2afz, H2AZ, H2AZ_HUMAN, Histone H2A.Z, MGC117173

UniProt

P0C0S5

Expression Region

1-128aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-335AA: 1-128AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTTMUSG00000002180 shRNA Plasmid (m)
sc-151400-SH 20 µg

OTTMUSG00000002180 shRNA Plasmid (m)

Sign In for Pricing
View Details
KRT20 3'UTR Lenti-reporter-Luc Vector
26006081 1.0 µg

KRT20 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Polyclonal Antibody to EGFR (Phospho-Thr678)
35-1176-100 100 µL

Polyclonal Antibody to EGFR (Phospho-Thr678)

Sign In for Pricing
View Details
Lentiviral mouse Calm1 shRNA (UAS) - Lentiviral mouse Calm1 shRNA (UAS, iRFP) (100)
GTR15198159 1 Vial

Lentiviral mouse Calm1 shRNA (UAS) - Lentiviral mouse Calm1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
SLA2 Polyclonal Conjugated Antibody
C27794 100 µL

SLA2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Guinea Pig VF ELISA Kit
EGV0010 96 Tests

Guinea Pig VF ELISA Kit

Sign In for Pricing
View Details