Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human H2AFZ protein

This Human H2AFZ protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H2A histone family member Z, H2A.z, H2A/z, H2afz, H2AZ, H2AZ_HUMAN, Histone H2A.Z, MGC117173

UniProt

P0C0S5

Expression Region

1-128aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-335AA: 1-128AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METAP1D Antibody
orb1286508 100 µL

METAP1D Antibody

Sign In for Pricing
View Details
Lentiviral human FAM171A1 shRNA (UAS) - Lentiviral human FAM171A1 shRNA (UAS, iRFP) plasmid
GTR15133708 1 Vial

Lentiviral human FAM171A1 shRNA (UAS) - Lentiviral human FAM171A1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
THRB1 Polyclonal Antibody
bs-11440R 100 µL

THRB1 Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome C (CYCS) Magnetic Fluorescence Assay Kit
MBS2155887-01 96 Tests

Cytochrome C (CYCS) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cytochrome C (CYCS) Magnetic Fluorescence Assay Kit
MBS2155887-02 5x 96 Tests

Cytochrome C (CYCS) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cytochrome C (CYCS) Magnetic Fluorescence Assay Kit
MBS2155887-03 10x 96 Tests

Cytochrome C (CYCS) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details