Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human H2AFZ protein

This Human H2AFZ protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H2A histone family member Z, H2A.z, H2A/z, H2afz, H2AZ, H2AZ_HUMAN, Histone H2A.Z, MGC117173

UniProt

P0C0S5

Expression Region

1-128aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-335AA: 1-128AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1069 siRNA Oligos set (Rat)
33646176 3x 5 nmol

Olr1069 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Rabbit anti-ZCCHC6 Antibody, Affinity Purified
A305-088A 100 µg

Rabbit anti-ZCCHC6 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit Polyclonal TDG Antibody [Alexa Fluor 750]
NBP2-32248AF750 0.1 mL

Rabbit Polyclonal TDG Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Phospho-Connexin 43 (Ser368) Rabbit pAb, Pacific Blue conjugated
orb2847571 100 µL

Phospho-Connexin 43 (Ser368) Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Actin Native Protein
32-3153-50 50 µg

Actin Native Protein

Sign In for Pricing
View Details
Rad51ap1 Mouse siRNA Oligo Duplex (Locus ID 19362)
SR411349 1 Kit

Rad51ap1 Mouse siRNA Oligo Duplex (Locus ID 19362)

Sign In for Pricing
View Details