Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLRX3 protein

This Human GLRX3 protein spans the amino acid sequence from region 1-335aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PKC-interacting cousin of thioredoxin

UniProt

O76003

Expression Region

1-335aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

64.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-124AA: 1-335AAFull Length of BC028113 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX17 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
45027154 3x 1.0 µg DNA

SNX17 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Ifi35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7360808 1.0 µg DNA

Ifi35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Nudt17 Rat shRNA Lentiviral Particle (Locus ID 502584)
TL707841V 500 µL Each

Nudt17 Rat shRNA Lentiviral Particle (Locus ID 502584)

Sign In for Pricing
View Details
Bruton'S Tyrosine Kinase (Btk) Magnetic Luminex Assay Kit
LKU600696 96 Tests

Bruton'S Tyrosine Kinase (Btk) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Prolyl Endopeptidase-Like (PREPL) Antibody
abx003213-01 100 µL

Prolyl Endopeptidase-Like (PREPL) Antibody

Sign In for Pricing
View Details
Prolyl Endopeptidase-Like (PREPL) Antibody
abx003213-02 200 µL

Prolyl Endopeptidase-Like (PREPL) Antibody

Sign In for Pricing
View Details