Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLRX2 protein

This Human GLRX2 protein spans the amino acid sequence from region 1-124aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2), bA101E13.1, CGI133, Glrx2, GLRX2_HUMAN, Glutaredoxin-2, Glutaredoxin-2, mitochondrial, GRX2, mitochondrial

UniProt

Q9NS18

Expression Region

1-124aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-102AA: 1-124AAFull Length : Full Length of BC028113

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Copeptin Elisa Kit
EKC36659 96 Tests

Mouse Copeptin Elisa Kit

Sign In for Pricing
View Details
SPR siRNA (Human)
CRH4567-01 15 nmol

SPR siRNA (Human)

Sign In for Pricing
View Details
SPR siRNA (Human)
CRH4567-02 30 nmol

SPR siRNA (Human)

Sign In for Pricing
View Details
TTC12 (B-1) P
sc-390229 P 100 µg - 0.5 mL

TTC12 (B-1) P

Sign In for Pricing
View Details
P Glycoprotein Recombinant Antibody, RBITC Conjugated
bsm-54782R-RBITC 100 µL

P Glycoprotein Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Human TMEM223 Pre-designed siRNA Set B
SI016901B 1 Each

Human TMEM223 Pre-designed siRNA Set B

Sign In for Pricing
View Details