Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CNOT8 protein

This Human CNOT8 protein spans the amino acid sequence from region 1-292aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAF1-like protein

UniProt

Q9UFF9

Expression Region

1-292aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-253AA: 1-292AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-4- (1H-imidazol-1-yl) pyrimidine
PEA83403 5 g

2-Chloro-4- (1H-imidazol-1-yl) pyrimidine

Sign In for Pricing
View Details
ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (APC)
MBS6166551-01 0.1 mL

ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (APC)

Sign In for Pricing
View Details
ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (APC)
MBS6166551-02 5x 0.1 mL

ZNF85 (Zinc Finger Protein 85, HPF4, HTF1, MGC78566) (APC)

Sign In for Pricing
View Details
Lisofylline (1- (5-Hydroxyhexyl) -3,7-dimethylxanthine)
L2638-30 25 mg

Lisofylline (1- (5-Hydroxyhexyl) -3,7-dimethylxanthine)

Sign In for Pricing
View Details
BPIL2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV815461 1.0 µg DNA

BPIL2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Renibacterium salmoninarum Peptidyl-tRNA hydrolase (pth)
MBS1231671-01 0.02 mg (E-Coli)

Recombinant Renibacterium salmoninarum Peptidyl-tRNA hydrolase (pth)

Sign In for Pricing
View Details