Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APRT protein

This Human APRT protein spans the amino acid sequence from region 1-180aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenine phosphoribosyltransferase, AMP, AMP diphosphorylase, AMP pyrophosphorylase, APRT, APT_HUMAN, DKFZp686D13177, MGC125856, MGC125857, MGC129961, Transphosphoribosidase

UniProt

P07741

Expression Region

1-180aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-204AA: 1-180AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM71 Knockout HEK293T cell line
GTR15409024 1 Vial

Human TMEM71 Knockout HEK293T cell line

Sign In for Pricing
View Details
Plane Mirrors, Glass, Unmounted
1110220/2A 1 Each

Plane Mirrors, Glass, Unmounted

Sign In for Pricing
View Details
MARCKS Antibody
MBS8512298-01 0.05 mg

MARCKS Antibody

Sign In for Pricing
View Details
MARCKS Antibody
MBS8512298-02 0.1 mg

MARCKS Antibody

Sign In for Pricing
View Details
MARCKS Antibody
MBS8512298-03 0.1 mL (AF750)

MARCKS Antibody

Sign In for Pricing
View Details
MARCKS Antibody
MBS8512298-04 0.1 mL (AF405M)

MARCKS Antibody

Sign In for Pricing
View Details