Human DEFA1 protein
This Human DEFA1 protein spans the amino acid sequence from region 1-94aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Defensin, alpha 1 HNP-1
UniProt
P59665
Expression Region
1-94aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
37.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-236AA: 1-94AAFull Length of BC039318 : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
12476094 4x 500 ng
Art2a-ps-set siRNA/shRNA/RNAi Lentivector (Mouse)
Sign In for Pricing
View Details MBS1493878-01 0.05 mg
Rabbit anti-human C-C motif chemokine 21 polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details MBS1493878-02 0.1 mg
Rabbit anti-human C-C motif chemokine 21 polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details MBS1493878-03 5x 0.1 mg
Rabbit anti-human C-C motif chemokine 21 polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details 
SR311953 1 Kit
FKSG14 (CENPK) Human siRNA Oligo Duplex (Locus ID 64105)
Sign In for Pricing
View Details