Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFA1 protein

This Human DEFA1 protein spans the amino acid sequence from region 1-94aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Defensin, alpha 1 HNP-1

UniProt

P59665

Expression Region

1-94aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-236AA: 1-94AAFull Length of BC039318 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr76 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
50368114 3x 1.0 µg

Wdr76 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
IMPG2 3'UTR GFP Stable Cell Line
TU061146 1.0 mL

IMPG2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD563345 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
Recombinant Human CLEC10A/CD301 (C-6His)
C587-50ug 50 µg

Recombinant Human CLEC10A/CD301 (C-6His)

Sign In for Pricing
View Details
Dcp2 3'UTR GFP Stable Cell Line
TU154906 1.0 mL

Dcp2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Phospho-EphB1+EphB2 (Tyr594) Rabbit Polyclonal Antibody (BF350)
orb2549725 100 µL

Phospho-EphB1+EphB2 (Tyr594) Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details