Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BCL2L14 protein

This Human BCL2L14 protein spans the amino acid sequence from region 1-327aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoptosis regulator Bcl-G

UniProt

Q9BZR8

Expression Region

1-327aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-190AA: 1-327AAFull Length of BC011739 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poly (pentafluorostyrene)
OR1078407-01 200 mg

Poly (pentafluorostyrene)

Sign In for Pricing
View Details
Poly (pentafluorostyrene)
OR1078407-02 1 g

Poly (pentafluorostyrene)

Sign In for Pricing
View Details
IDO1 antibody
70R-49920 100 ul

IDO1 antibody

Sign In for Pricing
View Details
14-3-3 sigma Recombinant Rabbit mAb
E43S47935 100 µL

14-3-3 sigma Recombinant Rabbit mAb

Sign In for Pricing
View Details
PLV3-CMV-Pgam1-3xFLAG-Fluc-Puro Plasmid
PVT80020 2 µg

PLV3-CMV-Pgam1-3xFLAG-Fluc-Puro Plasmid

Sign In for Pricing
View Details
PY26TEF-GPD-Neo Plasmid
PVT72934 2 µg

PY26TEF-GPD-Neo Plasmid

Sign In for Pricing
View Details