Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMF protein

This Human BMF protein spans the amino acid sequence from region 1-184aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bcl 2 modifying factor, Bcl-2-modifying factor, Bcl2 modifying factor, Bmf, BMF_HUMAN, FLJ00065

UniProt

Q96LC9

Expression Region

1-184aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-313AA: 1-184AAFull Length of Isoform 2 : Full Length of BC069505

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBS Mouse Monoclonal Antibody (Fluoro488)
orb3086129 100 µg

CBS Mouse Monoclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
nucleoporin p62 antibody
MBS9403328-01 0.1 mL

nucleoporin p62 antibody

Sign In for Pricing
View Details
nucleoporin p62 antibody
MBS9403328-02 5x 0.1 mL

nucleoporin p62 antibody

Sign In for Pricing
View Details
PHTF1 3'UTR Luciferase Stable Cell Line
TU017902 1.0 mL

PHTF1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Monoclonal Antibody to Bcl2 Like Protein 11 (BCL2L11)
TRV-0060675-01 20 µL

Monoclonal Antibody to Bcl2 Like Protein 11 (BCL2L11)

Sign In for Pricing
View Details
Monoclonal Antibody to Bcl2 Like Protein 11 (BCL2L11)
TRV-0060675-02 100 µL

Monoclonal Antibody to Bcl2 Like Protein 11 (BCL2L11)

Sign In for Pricing
View Details