Human BMF protein
This Human BMF protein spans the amino acid sequence from region 1-184aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Bcl 2 modifying factor, Bcl-2-modifying factor, Bcl2 modifying factor, Bmf, BMF_HUMAN, FLJ00065
UniProt
Q96LC9
Expression Region
1-184aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
47.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-313AA: 1-184AAFull Length of Isoform 2 : Full Length of BC069505
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15207323 1 Vial
Lentiviral mouse Rhag shRNA (UAS) - Lentiviral mouse Rhag shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details MBS1165158-01 0.02 mg (E-Coli)
Recombinant Mycobacterium vanbaalenii NADH-quinone oxidoreductase subunit C (nuoC)
Sign In for Pricing
View Details MBS1165158-02 0.1 mg (E-Coli)
Recombinant Mycobacterium vanbaalenii NADH-quinone oxidoreductase subunit C (nuoC)
Sign In for Pricing
View Details MBS1165158-03 0.02 mg (Yeast)
Recombinant Mycobacterium vanbaalenii NADH-quinone oxidoreductase subunit C (nuoC)
Sign In for Pricing
View Details