Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TCEB2 protein

This Human TCEB2 protein spans the amino acid sequence from region 1-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Elongin 18KDA subunit Elongin-B

UniProt

Q15370

Expression Region

1-118aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-240AA: 1-118AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Thrombomodulin ELISA Kit
orb442636-01 48 Tests

Rabbit Thrombomodulin ELISA Kit

Sign In for Pricing
View Details
Rabbit Thrombomodulin ELISA Kit
orb442636-02 96 Tests

Rabbit Thrombomodulin ELISA Kit

Sign In for Pricing
View Details
TKTL2 Protein Vector (Human) (pPM-C-HA)
PV058883 500 ng

TKTL2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Cytokeratin 14/KRT14 Antibody Picoband® (APC Conjugate)
A01432-APC 100 µg/Vial

Anti-Cytokeratin 14/KRT14 Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
HS1BP3 ORF Vector (Human) (pORF)
ORF005077 1.0 µg DNA

HS1BP3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Guinea pig Annexin V (ANX-V) ELISA Kit
MBS261319-01 48 Well

Guinea pig Annexin V (ANX-V) ELISA Kit

Sign In for Pricing
View Details