Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AK2 protein

This Human AK2 protein spans the amino acid sequence from region 1-239aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-AMP transphosphorylase 2 ATP, AMP phosphotransferase Adenylate monophosphate kinase

UniProt

P54819

Expression Region

1-239aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-156AA: 1-239AAFull Length : Full Length of BC009405

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

{4-[ (Trifluoromethyl) sulfanyl]phenyl}boronic acid
XMB53315-01 0.5 g

{4-[ (Trifluoromethyl) sulfanyl]phenyl}boronic acid

Sign In for Pricing
View Details
{4-[ (Trifluoromethyl) sulfanyl]phenyl}boronic acid
XMB53315-02 5 g

{4-[ (Trifluoromethyl) sulfanyl]phenyl}boronic acid

Sign In for Pricing
View Details
Anti-FKBPL Antibody (7Q420)
TMAB-06051-01 25 µL

Anti-FKBPL Antibody (7Q420)

Sign In for Pricing
View Details
Anti-FKBPL Antibody (7Q420)
TMAB-06051-02 50 μL

Anti-FKBPL Antibody (7Q420)

Sign In for Pricing
View Details
Anti-FKBPL Antibody (7Q420)
TMAB-06051-03 100 µL

Anti-FKBPL Antibody (7Q420)

Sign In for Pricing
View Details
Rabbit Anti MICA Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC)
IRBAMLMICAAP287200UL 1 Each

Rabbit Anti MICA Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC)

Sign In for Pricing
View Details