Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AK2 protein

This Human AK2 protein spans the amino acid sequence from region 1-239aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP-AMP transphosphorylase 2 ATP, AMP phosphotransferase Adenylate monophosphate kinase

UniProt

P54819

Expression Region

1-239aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-156AA: 1-239AAFull Length : Full Length of BC009405

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Protein translocase subunit SecF (secF)
orb2910044-01 20 µg

Recombinant Protein translocase subunit SecF (secF)

Sign In for Pricing
View Details
Recombinant Protein translocase subunit SecF (secF)
orb2910044-02 100 µg

Recombinant Protein translocase subunit SecF (secF)

Sign In for Pricing
View Details
COL17A1 Protein Vector (Mouse) (pPM-C-His)
PV167041 500 ng

COL17A1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CHD7 siRNA (Human)
MBS8203875-01 15 nmol

CHD7 siRNA (Human)

Sign In for Pricing
View Details
CHD7 siRNA (Human)
MBS8203875-02 30 nmol

CHD7 siRNA (Human)

Sign In for Pricing
View Details
CHD7 siRNA (Human)
MBS8203875-03 5x 30 nmol

CHD7 siRNA (Human)

Sign In for Pricing
View Details