What is the catalog number for Human NCBP2 protein?

The catalog number for Human NCBP2 protein is orb54224.

What sizes are available for Human NCBP2 protein?

Human NCBP2 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human NCBP2 protein come in?

Human NCBP2 protein is available in 3 different pack sizes.

Is Human NCBP2 protein in stock?

Human NCBP2 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human NCBP2 protein

This Human NCBP2 protein spans the amino acid sequence from region 1-156aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

20KDA nuclear cap-binding protein Cell proliferation-inducing gene 55 protein NCBP 20KDA subunit

UniProt

P52298

Expression Region

1-156aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-128AA: 1-156AAFull Length of BC022489 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ