Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FABP6 protein

This Human FABP6 protein spans the amino acid sequence from region 1-128aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fatty acid-binding protein 6 Ileal lipid-binding protein

UniProt

P51161

Expression Region

1-128aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-295AA: 1-128AAFull Length of BC000923: Full Length of BC022489

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antimitotic agent-2
T212280-01 10 mg

Antimitotic agent-2

Sign In for Pricing
View Details
Antimitotic agent-2
T212280-02 50 mg

Antimitotic agent-2

Sign In for Pricing
View Details
CASP3 Antibody (FITC)
orb238199-01 50 µg

CASP3 Antibody (FITC)

Sign In for Pricing
View Details
CASP3 Antibody (FITC)
orb238199-02 100 µg

CASP3 Antibody (FITC)

Sign In for Pricing
View Details
DOCK1 Rabbit Polyclonal Antibody (AP)
orb884314 100 µL

DOCK1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
TBL1X Monoclonal Antibody
MBS9525111-01 0.05 mL

TBL1X Monoclonal Antibody

Sign In for Pricing
View Details