What is the catalog number for Human SULT1A1 protein?

The catalog number for Human SULT1A1 protein is orb54222.

What sizes are available for Human SULT1A1 protein?

Human SULT1A1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human SULT1A1 protein come in?

Human SULT1A1 protein is available in 3 different pack sizes.

Is Human SULT1A1 protein in stock?

Human SULT1A1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human SULT1A1 protein

This Human SULT1A1 protein spans the amino acid sequence from region 1-295aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aryl sulfotransferase 1 HAST1/HAST2 Phenol sulfotransferase 1 Phenol-sulfating phenol sulfotransferase 1

UniProt

P50225

Expression Region

1-295aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-323AA: 1-295AAFull Length : Full Length of BC000923

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL