Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SULT1A1 protein

This Human SULT1A1 protein spans the amino acid sequence from region 1-295aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aryl sulfotransferase 1 HAST1/HAST2 Phenol sulfotransferase 1 Phenol-sulfating phenol sulfotransferase 1

UniProt

P50225

Expression Region

1-295aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-323AA: 1-295AAFull Length : Full Length of BC000923

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0258605 3x 1.0 µg

C8orf16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ARL15 Antibody
5263-01 0.02 mg

ARL15 Antibody

Sign In for Pricing
View Details
ARL15 Antibody
5263-02 0.1 mg

ARL15 Antibody

Sign In for Pricing
View Details
C9orf123 shRNA (h) Lentiviral Particles
sc-92921-V 200 µL

C9orf123 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
HIV-1 tat, aa1-16, NT, HXB2 (Human Immunodeficiency Virus-1) (FITC) discontinued, see 052189
H6007-02-FITC 100 µL

HIV-1 tat, aa1-16, NT, HXB2 (Human Immunodeficiency Virus-1) (FITC) discontinued, see 052189

Sign In for Pricing
View Details
Rabbit Polyclonal ZDHHC6 Antibody
NBP2-94489-0.1mL 0.1 mL

Rabbit Polyclonal ZDHHC6 Antibody

Sign In for Pricing
View Details