Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AKR1C3 protein

This Human AKR1C3 protein spans the amino acid sequence from region 1-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

17-beta-hydroxysteroid dehydrogenase type 5

UniProt

P42330

Expression Region

1-323aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-339AA: 1-323AAFull Length of BC001785: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHIC2 CRISPRa sgRNA lentivector (set of three targets)(Human)
16069121 3x 1.0µg DNA

CHIC2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Human WARS-Tryptophanyl tRNA Synthetase- ELISA Kit
E-EL-H1874-01 24 Tests

Human WARS-Tryptophanyl tRNA Synthetase- ELISA Kit

Sign In for Pricing
View Details
Human WARS-Tryptophanyl tRNA Synthetase- ELISA Kit
E-EL-H1874-02 48 Tests

Human WARS-Tryptophanyl tRNA Synthetase- ELISA Kit

Sign In for Pricing
View Details
Human WARS-Tryptophanyl tRNA Synthetase- ELISA Kit
E-EL-H1874-03 96 Tests

Human WARS-Tryptophanyl tRNA Synthetase- ELISA Kit

Sign In for Pricing
View Details
Human WARS-Tryptophanyl tRNA Synthetase- ELISA Kit
E-EL-H1874-04 5x 96 Tests

Human WARS-Tryptophanyl tRNA Synthetase- ELISA Kit

Sign In for Pricing
View Details
Human WARS-Tryptophanyl tRNA Synthetase- ELISA Kit
E-EL-H1874-05 10x 96 Tests

Human WARS-Tryptophanyl tRNA Synthetase- ELISA Kit

Sign In for Pricing
View Details