Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AKR1C3 protein

This Human AKR1C3 protein spans the amino acid sequence from region 1-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

17-beta-hydroxysteroid dehydrogenase type 5

UniProt

P42330

Expression Region

1-323aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-339AA: 1-323AAFull Length of BC001785: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Burkholderia pseudomallei Catalase-peroxidase (katG), partial
MBS1336998 Inquire

Recombinant Burkholderia pseudomallei Catalase-peroxidase (katG), partial

Sign In for Pricing
View Details
Acp5 Rat shRNA Lentiviral Particle (Locus ID 25732)
TL710166V 500 µL Each

Acp5 Rat shRNA Lentiviral Particle (Locus ID 25732)

Sign In for Pricing
View Details
EGFL6 Protein Vector (Human) (pPB-N-His)
PV013718 500 ng

EGFL6 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
NAB1 Human Over-expression Lysate
orb1357446 100 µg

NAB1 Human Over-expression Lysate

Sign In for Pricing
View Details
LIN52, NT (LIN52, C14orf46, Protein lin-52 homolog)
037800 200 µL

LIN52, NT (LIN52, C14orf46, Protein lin-52 homolog)

Sign In for Pricing
View Details
Ly96 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4440008 1.0 µg DNA

Ly96 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details