What is the catalog number for Human SRI protein?

The catalog number for Human SRI protein is orb54219.

What sizes are available for Human SRI protein?

Human SRI protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human SRI protein come in?

Human SRI protein is available in 3 different pack sizes.

Is Human SRI protein in stock?

Human SRI protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human SRI protein

This Human SRI protein spans the amino acid sequence from region 1-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

22KDA protein CP-22

UniProt

P30626

Expression Region

1-198aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-129AA: 1-198AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV