Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human H1F0 protein

This Human H1F0 protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H1' Histone H1 (0)

UniProt

P07305

Expression Region

1-194aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-322AA: 1-194AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEH1 (Melanoma-associated Antigen H1, MAGE-H1 Antigen, Restin, Apoptosis-related Protein 1, APR-1, APR1) (HRP)
MBS6153399-01 0.1 mL

MAGEH1 (Melanoma-associated Antigen H1, MAGE-H1 Antigen, Restin, Apoptosis-related Protein 1, APR-1, APR1) (HRP)

Sign In for Pricing
View Details
MAGEH1 (Melanoma-associated Antigen H1, MAGE-H1 Antigen, Restin, Apoptosis-related Protein 1, APR-1, APR1) (HRP)
MBS6153399-02 5x 0.1 mL

MAGEH1 (Melanoma-associated Antigen H1, MAGE-H1 Antigen, Restin, Apoptosis-related Protein 1, APR-1, APR1) (HRP)

Sign In for Pricing
View Details
TRNAQ18 sgRNA CRISPR Lentivector set (Human)
K2514601 3x 1.0 µg

TRNAQ18 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
SLC9A5 peptide
orb218876-01 1 mg

SLC9A5 peptide

Sign In for Pricing
View Details
SLC9A5 peptide
orb218876-02 5 mg

SLC9A5 peptide

Sign In for Pricing
View Details
Interleukin 20 (IL20) Antibody
abx177141-01 100 µL

Interleukin 20 (IL20) Antibody

Sign In for Pricing
View Details