Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human H1F0 protein

This Human H1F0 protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H1' Histone H1 (0)

UniProt

P07305

Expression Region

1-194aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-322AA: 1-194AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR174 Antibody
E19-4902 100 µg -100 µL

GPR174 Antibody

Sign In for Pricing
View Details
NIF3L1 Polyclonal Antibody
CAC14452-01 50 µg

NIF3L1 Polyclonal Antibody

Sign In for Pricing
View Details
NIF3L1 Polyclonal Antibody
CAC14452-02 100 µg

NIF3L1 Polyclonal Antibody

Sign In for Pricing
View Details
Mpn2 3'UTR Luciferase Stable Cell Line
TU213338 1.0 mL

Mpn2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TACC2 Polyclonal Antibody
bs-5736R 100 µL

TACC2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Staphylococcus aureus Protein A/SPA Antibody (SAA1452), FITC
MBS1586291-01 50 Tests

Anti-Staphylococcus aureus Protein A/SPA Antibody (SAA1452), FITC

Sign In for Pricing
View Details