What is the catalog number for Human LRP4 protein?

The catalog number for Human LRP4 protein is orb54214.

What sizes are available for Human LRP4 protein?

Human LRP4 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human LRP4 protein come in?

Human LRP4 protein is available in 3 different pack sizes.

Is Human LRP4 protein in stock?

Human LRP4 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human LRP4 protein

This Human LRP4 protein spans the amino acid sequence from region 1747-1905aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Multiple epidermal growth factor-like domains 7

UniProt

O75096

Expression Region

1747-1905aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Developmental Biology, Epigenetics, Neuroscience, Signaling Pathways, Wnt

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 6xHis-tagged2-484AA: 1747-1905AAFull Length of Mature Protein: Cytoplasmic Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV