Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral UL111A protein

This Viral UL111A protein spans the amino acid sequence from region 26-176aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CmvIL-10 (vIL-10)

UniProt

F5HC71

Expression Region

26-176aa

Tag

N-terminal 10xHis-SUMO-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged: NO-tagged1-408AA: 26-176AAFull Length: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Dimer antibody
NBP2088 1 mg

D-Dimer antibody

Sign In for Pricing
View Details
VASH2 Antibody
orb682196 100 µL

VASH2 Antibody

Sign In for Pricing
View Details
Human MMP2 (active) Protein, His tag (Animal-Free)
MBS9719491-01 0.005 mg

Human MMP2 (active) Protein, His tag (Animal-Free)

Sign In for Pricing
View Details
Human MMP2 (active) Protein, His tag (Animal-Free)
MBS9719491-02 0.02 mg

Human MMP2 (active) Protein, His tag (Animal-Free)

Sign In for Pricing
View Details
Human MMP2 (active) Protein, His tag (Animal-Free)
MBS9719491-03 0.1 mg

Human MMP2 (active) Protein, His tag (Animal-Free)

Sign In for Pricing
View Details
Human MMP2 (active) Protein, His tag (Animal-Free)
MBS9719491-04 5x 0.1 mg

Human MMP2 (active) Protein, His tag (Animal-Free)

Sign In for Pricing
View Details