Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ODAM protein

This Human ODAM protein spans the amino acid sequence from region 16-279aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apin

UniProt

A1E959

Expression Region

16-279aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged24-508AA: 16-279AAPartial : Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Bahcc1 shRNA (UAS) - Lentiviral mouseBahcc1 shRNA (UAS, GFP) (25)
GTR15185048 1 Vial

Lentiviral mouse Bahcc1 shRNA (UAS) - Lentiviral mouseBahcc1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Microfibrillar associated protein 4 (MFAP4) Human ELISA Kit
E9905 96 Tests

Microfibrillar associated protein 4 (MFAP4) Human ELISA Kit

Sign In for Pricing
View Details
CIDEA (Cell Death Activator CIDE-A, Cell Death-inducing DFFA-like Effector A, CIDE-A) (PE)
125003-PE 100 µL

CIDEA (Cell Death Activator CIDE-A, Cell Death-inducing DFFA-like Effector A, CIDE-A) (PE)

Sign In for Pricing
View Details
CTCE 9908 acetate
MBS5789508 Inquire

CTCE 9908 acetate

Sign In for Pricing
View Details
FAM87A sgRNA CRISPR Lentivector (Human) (Target 3)
K0734204 1.0 µg DNA

FAM87A sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Fabric mantle for erlenmeyer flask 125ml, 95W, 230V
100A O913 1 Each

Fabric mantle for erlenmeyer flask 125ml, 95W, 230V

Sign In for Pricing
View Details