Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ODAM protein

This Human ODAM protein spans the amino acid sequence from region 16-279aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apin

UniProt

A1E959

Expression Region

16-279aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-tagged: N-terminal 6xHis-SUMO-tagged24-508AA: 16-279AAPartial : Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Collagen Type IV Alpha 1 (COL4a1) ELISA Kit
orb776705-01 48 Tests

Mouse Collagen Type IV Alpha 1 (COL4a1) ELISA Kit

Sign In for Pricing
View Details
Mouse Collagen Type IV Alpha 1 (COL4a1) ELISA Kit
orb776705-02 96 Tests

Mouse Collagen Type IV Alpha 1 (COL4a1) ELISA Kit

Sign In for Pricing
View Details
ADCYAP1 Protein Vector (Mouse) (pPM-C-HA)
11401024 500 ng

ADCYAP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
rel-MDM2/4-p53-IN-2
MBS5806416 Inquire

rel-MDM2/4-p53-IN-2

Sign In for Pricing
View Details
LIMD1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV698149 1.0 µg DNA

LIMD1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GMEB2 Conjugated Antibody
MBS9455431-01 0.1 mL (Biotin)

GMEB2 Conjugated Antibody

Sign In for Pricing
View Details